PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G352200.1.p
Common NameSb03g039470, SORBIDRAFT_03g039470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 564aa    MW: 61229.8 Da    PI: 9.4751
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G352200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-1765111148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g WT+eEde l +av+ + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Sobic.003G352200.1.p  65 KGGWTPEEDETLRKAVEAFKGRNWKKIAEFFQ-DRTEVQCLHRWQKVL 111
                           688*****************************.************986 PP

2Myb_DNA-binding60.44e-19117163148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+WT+eEde+++d+v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
  Sobic.003G352200.1.p 117 KGPWTQEEDEKIIDLVGKYGPTKWSIIAKSLP-GRIGKQCRERWHNHL 163
                           79******************************.*************97 PP

3Myb_DNA-binding57.23.8e-18169212146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +++WT+eE+  l++a+k +G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.003G352200.1.p 169 KDAWTPEEERALINAHKVFGNK-WAEIAKALP-GRTDNSIKNHWNS 212
                           679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.95560111IPR017930Myb domain
SMARTSM007175.0E-1564113IPR001005SANT/Myb domain
PfamPF002498.0E-1665111IPR001005SANT/Myb domain
SuperFamilySSF466891.0E-1566121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-2367123IPR009057Homeodomain-like
CDDcd001671.06E-1368111No hitNo description
PROSITE profilePS5129432.451112167IPR017930Myb domain
SuperFamilySSF466892.05E-32114210IPR009057Homeodomain-like
SMARTSM007175.4E-18116165IPR001005SANT/Myb domain
PfamPF002498.6E-18117163IPR001005SANT/Myb domain
CDDcd001675.23E-16119163No hitNo description
Gene3DG3DSA:1.10.10.602.7E-27124170IPR009057Homeodomain-like
PROSITE profilePS5129423.671168218IPR017930Myb domain
SMARTSM007171.5E-17168216IPR001005SANT/Myb domain
PfamPF002493.1E-16169212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-24171218IPR009057Homeodomain-like
CDDcd001674.14E-14171214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MGAMAEVVQE GCVENRQPLA ASSSSVSDGS SCGGGGRAGT SPPVSSSGNS ISVLRRTSGP  60
IRRAKGGWTP EEDETLRKAV EAFKGRNWKK IAEFFQDRTE VQCLHRWQKV LNPELIKGPW  120
TQEEDEKIID LVGKYGPTKW SIIAKSLPGR IGKQCRERWH NHLNPEIRKD AWTPEEERAL  180
INAHKVFGNK WAEIAKALPG RTDNSIKNHW NSSLRKKLEA YSNSSVLSAP KLFVHDDFKD  240
KMKPVGTDSH LDLNQMPSIG SKDVPGRAYR SILSPPSQAY NLDSSGFLSL SIPTVQPLTK  300
YEMPSLVDGS AVTLAVQGLE SDSVRDKGLE IDAVHEKGVE VSSTPDPVGV ELESAPAKRG  360
AVLSSKNELH STLGPLCYQI PNMEYVAPIR TPLRSECNGS HQTQHFMSPN GYTSPSPTIG  420
KVSSQLTVDS ILRIAADSFP GTPSILRKRK RDKATPASGN ELKTGGVSND SFYTPNGTNG  480
KDTTPRSFKT AASFLSLGSV DGLLTSVRSF DSSPPYQKRS KRMAIIKSVE KQLDFSADGL  540
DTSGSEMKNS PCHNSQGANS NRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-74642185159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-74642185159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446452RKRKRDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.113150.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0430900.0BT043090.1 Zea mays full-length cDNA clone ZM_BFc0095F17 mRNA, complete cds.
GenBankBT0549160.0BT054916.1 Zea mays full-length cDNA clone ZM_BFc0181A17 mRNA, complete cds.
GenBankEU9707920.0EU970792.1 Zea mays clone 350916 myb-like DNA-binding domain containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456618.10.0hypothetical protein SORBIDRAFT_03g039470
TrEMBLC5XPP60.0C5XPP6_SORBI; Putative uncharacterized protein Sb03g039470
STRINGSb03g039470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-106myb domain protein 3r-5